PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA53G01024
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 168aa    MW: 19061.4 Da    PI: 9.7359
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA53G01024genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.61.2e-172067148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd++l+++++ +G g W++ a+  g++Rt+k+c++rw++yl
       AA53G01024 20 KGPWTMEEDLILINYIANHGDGVWNSLAKSAGLKRTGKSCRLRWLNYL 67
                     79********************************************97 PP

2Myb_DNA-binding54.72.4e-1773116146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T+eE++++ ++++++G++ W++Ia++++ gRt++++k++w++
       AA53G01024  73 RGNITPEEQLIIMELHAKWGNR-WSKIAKHLP-GRTDNEIKNFWRT 116
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.3781567IPR017930Myb domain
SuperFamilySSF466893.56E-3018114IPR009057Homeodomain-like
SMARTSM007171.8E-121969IPR001005SANT/Myb domain
PfamPF002491.1E-162067IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.5E-232174IPR009057Homeodomain-like
CDDcd001675.12E-102267No hitNo description
PROSITE profilePS5129424.86568122IPR017930Myb domain
SMARTSM007175.0E-1572120IPR001005SANT/Myb domain
PfamPF002494.2E-1673116IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.2E-2575121IPR009057Homeodomain-like
CDDcd001671.05E-1177116No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0080086Biological Processstamen filament development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 168 aa     Download sequence    Send to blast
MEKVRGSSSG STGEEGEVRK GPWTMEEDLI LINYIANHGD GVWNSLAKSA GLKRTGKSCR  60
LRWLNYLRPD VRRGNITPEE QLIIMELHAK WGNRWSKIAK HLPGRTDNEI KNFWRTRIQK  120
YIKQGEITTT SSVGSHHSSS EMNDQAASTT SHVFCPQEVM ESYSPTKT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-261712224128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_189418.21e-100transcription factor MYB21
RefseqXP_002875402.11e-100ATMYB21
SwissprotQ9LK951e-102MYB21_ARATH; Transcription factor MYB21
TrEMBLD7LPK41e-100D7LPK4_ARALL; ATMYB21
STRINGAT3G27810.11e-99(Arabidopsis thaliana)
STRINGfgenesh1_pm.C_scaffold_50004451e-99(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27810.16e-91myb domain protein 21